Brand: | Abnova |
Reference: | H00006677-A01 |
Product name: | SPAM1 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant SPAM1. |
Gene id: | 6677 |
Gene name: | SPAM1 |
Gene alias: | HYA1|HYAL1|HYAL3|HYAL5|MGC26532|PH-20|PH20|SPAG15 |
Gene description: | sperm adhesion molecule 1 (PH-20 hyaluronidase, zona pellucida binding) |
Genbank accession: | NM_003117 |
Immunogen: | SPAM1 (NP_003108, 346 a.a. ~ 445 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | RSMKSCLLLDNYMETILNPYIINVTLAAKMCSQVLCQEQGVCIRKNWNSSDYLHLNPDNFAIQLEKGGKFTVRGKPTLEDLEQFSEKFYCSCYSTLSCKE |
Protein accession: | NP_003108 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | The impact of oxidative stress on chaperone-mediated human sperm-egg interaction.Bromfield EG, Aitken RJ, Anderson AL, McLaughlin EA, Nixon B. Hum Reprod. 2015 Sep 7.[Epub ahead of print] |