SPAG4 monoclonal antibody (M04), clone 3C8 View larger

SPAG4 monoclonal antibody (M04), clone 3C8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SPAG4 monoclonal antibody (M04), clone 3C8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about SPAG4 monoclonal antibody (M04), clone 3C8

Brand: Abnova
Reference: H00006676-M04
Product name: SPAG4 monoclonal antibody (M04), clone 3C8
Product description: Mouse monoclonal antibody raised against a partial recombinant SPAG4.
Clone: 3C8
Isotype: IgG1 Kappa
Gene id: 6676
Gene name: SPAG4
Gene alias: -
Gene description: sperm associated antigen 4
Genbank accession: NM_003116
Immunogen: SPAG4 (NP_003107, 221 a.a. ~ 330 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: AELDKLHKEVSTVRAANSERVAKLVFQRLNEDFVRKPDYALSSVGASIDLQKTSHDYADRNTAYFWNRFSFWNYARPPTVILEPHVFPGNCWAFEGDQGQVVIQLPGRVQ
Protein accession: NP_003107
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006676-M04-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006676-M04-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged SPAG4 is 1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SPAG4 monoclonal antibody (M04), clone 3C8 now

Add to cart