Brand: | Abnova |
Reference: | H00006672-M03 |
Product name: | SP100 monoclonal antibody (M03), clone 2E2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SP100. |
Clone: | 2E2 |
Isotype: | IgG2a Kappa |
Gene id: | 6672 |
Gene name: | SP100 |
Gene alias: | DKFZp686E07254|FLJ00340|FLJ34579 |
Gene description: | SP100 nuclear antigen |
Genbank accession: | NM_003113 |
Immunogen: | SP100 (NP_003104, 1 a.a. ~ 98 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MAGGGGDLSTRRLNECISPVANEMNHLPAHSHDLQRMFTEDQGVDDRLLYDIVFKHFKRNKVEISNAIKKTFPFLEGLRDRDLITNKMFEDSQDSCRN |
Protein accession: | NP_003104 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged SP100 is approximately 0.3ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |