SP100 monoclonal antibody (M02), clone 1G6 View larger

SP100 monoclonal antibody (M02), clone 1G6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SP100 monoclonal antibody (M02), clone 1G6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab

More info about SP100 monoclonal antibody (M02), clone 1G6

Brand: Abnova
Reference: H00006672-M02
Product name: SP100 monoclonal antibody (M02), clone 1G6
Product description: Mouse monoclonal antibody raised against a partial recombinant SP100.
Clone: 1G6
Isotype: IgG2a Kappa
Gene id: 6672
Gene name: SP100
Gene alias: DKFZp686E07254|FLJ00340|FLJ34579
Gene description: SP100 nuclear antigen
Genbank accession: NM_003113
Immunogen: SP100 (NP_003104, 1 a.a. ~ 98 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MAGGGGDLSTRRLNECISPVANEMNHLPAHSHDLQRMFTEDQGVDDRLLYDIVFKHFKRNKVEISNAIKKTFPFLEGLRDRDLITNKMFEDSQDSCRN
Protein accession: NP_003104
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006672-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.52 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006672-M02-13-15-1.jpg
Application image note: Western Blot analysis of SP100 expression in transfected 293T cell line by SP100 monoclonal antibody (M02), clone 1G6.

Lane 1: SP100 transfected lysate(100.417 KDa).
Lane 2: Non-transfected lysate.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab
Shipping condition: Dry Ice
Publications: Quantification of the Host Response Proteome after Herpes Simplex 1 Virus infection.Berard AR, Coombs KM, Severini A
J Proteome Res. 2015 Apr 15.

Reviews

Buy SP100 monoclonal antibody (M02), clone 1G6 now

Add to cart