Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
Brand: | Abnova |
Reference: | H00006672-M02 |
Product name: | SP100 monoclonal antibody (M02), clone 1G6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SP100. |
Clone: | 1G6 |
Isotype: | IgG2a Kappa |
Gene id: | 6672 |
Gene name: | SP100 |
Gene alias: | DKFZp686E07254|FLJ00340|FLJ34579 |
Gene description: | SP100 nuclear antigen |
Genbank accession: | NM_003113 |
Immunogen: | SP100 (NP_003104, 1 a.a. ~ 98 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MAGGGGDLSTRRLNECISPVANEMNHLPAHSHDLQRMFTEDQGVDDRLLYDIVFKHFKRNKVEISNAIKKTFPFLEGLRDRDLITNKMFEDSQDSCRN |
Protein accession: | NP_003104 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of SP100 expression in transfected 293T cell line by SP100 monoclonal antibody (M02), clone 1G6. Lane 1: SP100 transfected lysate(100.417 KDa). Lane 2: Non-transfected lysate. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
Shipping condition: | Dry Ice |
Publications: | Quantification of the Host Response Proteome after Herpes Simplex 1 Virus infection.Berard AR, Coombs KM, Severini A J Proteome Res. 2015 Apr 15. |