Brand: | Abnova |
Reference: | H00006670-M23 |
Product name: | SP3 monoclonal antibody (M23), clone 2D8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SP3. |
Clone: | 2D8 |
Isotype: | IgG2b Kappa |
Gene id: | 6670 |
Gene name: | SP3 |
Gene alias: | DKFZp686O1631|SPR-2 |
Gene description: | Sp3 transcription factor |
Genbank accession: | NM_003111.1 |
Immunogen: | SP3 (NP_003102.1, 516 a.a. ~ 615 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | GQLPNLQTVTVNSIDSAGIQLHPGENADSPADIRIKEEEPDPEEWQLSGDSTLNTNDLTHLRVQVVDEEGDQQHQEGKRLRRVACTCPNCKEGGGRGTNL |
Protein accession: | NP_003102.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |