SP3 monoclonal antibody (M21), clone 1G9 View larger

SP3 monoclonal antibody (M21), clone 1G9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SP3 monoclonal antibody (M21), clone 1G9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about SP3 monoclonal antibody (M21), clone 1G9

Brand: Abnova
Reference: H00006670-M21
Product name: SP3 monoclonal antibody (M21), clone 1G9
Product description: Mouse monoclonal antibody raised against a partial recombinant SP3.
Clone: 1G9
Isotype: IgG2a Kappa
Gene id: 6670
Gene name: SP3
Gene alias: DKFZp686O1631|SPR-2
Gene description: Sp3 transcription factor
Genbank accession: NM_003111.1
Immunogen: SP3 (NP_003102.1, 516 a.a. ~ 615 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GQLPNLQTVTVNSIDSAGIQLHPGENADSPADIRIKEEEPDPEEWQLSGDSTLNTNDLTHLRVQVVDEEGDQQHQEGKRLRRVACTCPNCKEGGGRGTNL
Protein accession: NP_003102.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006670-M21-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SP3 monoclonal antibody (M21), clone 1G9 now

Add to cart