SP3 monoclonal antibody (M12), clone 3G5 View larger

SP3 monoclonal antibody (M12), clone 3G5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SP3 monoclonal antibody (M12), clone 3G5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,ELISA,WB-Re

More info about SP3 monoclonal antibody (M12), clone 3G5

Brand: Abnova
Reference: H00006670-M12
Product name: SP3 monoclonal antibody (M12), clone 3G5
Product description: Mouse monoclonal antibody raised against a full length recombinant SP3.
Clone: 3G5
Isotype: IgG2a Kappa
Gene id: 6670
Gene name: SP3
Gene alias: DKFZp686O1631|SPR-2
Gene description: Sp3 transcription factor
Genbank accession: NM_003111
Immunogen: SP3 (NP_003102, 287 a.a. ~ 430 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: TAGINADGHLINTGQAMDSSDNSERTGERVSPDINETNTDTDLFVPTSSSSQLPVTIDSTGILQQNTNSLTTSSGQVHSSDLQGNYIQSPVSEETQAQNIQVSTAQPVVQHLQLQESQQPTSQAQIVQGITPQTIHGVQASGQN*
Protein accession: NP_003102
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006670-M12-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (41.95 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006670-M12-2-A3-1.jpg
Application image note: SP3 monoclonal antibody (M12), clone 3G5. Western Blot analysis of SP3 expression in human stomach.
Applications: WB-Ti,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SP3 monoclonal antibody (M12), clone 3G5 now

Add to cart