SP2 monoclonal antibody (M01), clone 5D3 View larger

SP2 monoclonal antibody (M01), clone 5D3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SP2 monoclonal antibody (M01), clone 5D3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about SP2 monoclonal antibody (M01), clone 5D3

Brand: Abnova
Reference: H00006668-M01
Product name: SP2 monoclonal antibody (M01), clone 5D3
Product description: Mouse monoclonal antibody raised against a partial recombinant SP2.
Clone: 5D3
Isotype: IgG2a Kappa
Gene id: 6668
Gene name: SP2
Gene alias: -
Gene description: Sp2 transcription factor
Genbank accession: NM_003110
Immunogen: SP2 (NP_003101.2, 71 a.a. ~ 161 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SPGKNSFGILSSKGNILQIQGSQLSASYPGGQLVFAIQNPTMINKGTRSNANIQYQAVPQIQASNSQTIQVQPNLTNQIQIIPGTNQAIIT
Protein accession: NP_003101.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006668-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.75 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006668-M01-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged SP2 is 0.03 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy SP2 monoclonal antibody (M01), clone 5D3 now

Add to cart