SP1 monoclonal antibody (M11), clone 1G9 View larger

SP1 monoclonal antibody (M11), clone 1G9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SP1 monoclonal antibody (M11), clone 1G9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,ELISA,WB-Re

More info about SP1 monoclonal antibody (M11), clone 1G9

Brand: Abnova
Reference: H00006667-M11
Product name: SP1 monoclonal antibody (M11), clone 1G9
Product description: Mouse monoclonal antibody raised against a full length recombinant SP1.
Clone: 1G9
Isotype: IgG2a Kappa
Gene id: 6667
Gene name: SP1
Gene alias: -
Gene description: Sp1 transcription factor
Genbank accession: NM_138473
Immunogen: SP1 (NP_612482, 522 a.a. ~ 618 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: QLSSMPGLQTINLSALGTSGIQVHPIQGLPLAIANAPGDHGAQLGLHGAGGDGIHDDTAGGEEGENSPDAQPQAGRRTRREACTCPYCKDSEGRGSG*
Protein accession: NP_612482
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006667-M11-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.78 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006667-M11-4-1-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to SP1 on HeLa cell . [antibody concentration 10 ug/ml]
Applications: IF,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SP1 monoclonal antibody (M11), clone 1G9 now

Add to cart