SP1 monoclonal antibody (M08), clone 2G5 View larger

SP1 monoclonal antibody (M08), clone 2G5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SP1 monoclonal antibody (M08), clone 2G5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about SP1 monoclonal antibody (M08), clone 2G5

Brand: Abnova
Reference: H00006667-M08
Product name: SP1 monoclonal antibody (M08), clone 2G5
Product description: Mouse monoclonal antibody raised against a full length recombinant SP1.
Clone: 2G5
Isotype: IgG2a Kappa
Gene id: 6667
Gene name: SP1
Gene alias: -
Gene description: Sp1 transcription factor
Genbank accession: NM_138473
Immunogen: SP1 (NP_612482, 522 a.a. ~ 618 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: QLSSMPGLQTINLSALGTSGIQVHPIQGLPLAIANAPGDHGAQLGLHGAGGDGIHDDTAGGEEGENSPDAQPQAGRRTRREACTCPYCKDSEGRGSG*
Protein accession: NP_612482
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006667-M08-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.78 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Mouse
Application image: H00006667-M08-1-1-1.jpg
Application image note: SP1 monoclonal antibody (M08), clone 2G5 Western Blot analysis of SP1 expression in HeLa ( Cat # L013V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SP1 monoclonal antibody (M08), clone 2G5 now

Add to cart