SP1 monoclonal antibody (M02), clone 1A5 View larger

SP1 monoclonal antibody (M02), clone 1A5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SP1 monoclonal antibody (M02), clone 1A5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse
Host speciesMouse
ApplicationsWB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re

More info about SP1 monoclonal antibody (M02), clone 1A5

Brand: Abnova
Reference: H00006667-M02
Product name: SP1 monoclonal antibody (M02), clone 1A5
Product description: Mouse monoclonal antibody raised against a partial recombinant SP1.
Clone: 1A5
Isotype: IgG1
Gene id: 6667
Gene name: SP1
Gene alias: -
Gene description: Sp1 transcription factor
Genbank accession: NM_138473
Immunogen: SP1 (NP_612482, 89 a.a. ~ 198 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GTGELDLTATQLSQGANGWQIISSSSGATPTSKEQSGSSTNGSNGSESSKNRTVSGGQYVVAAAPNLQNQQVLTGLPGVMPNIQYQVIPQFQTVDGQQLQFAATGAQVQQ
Protein accession: NP_612482
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006667-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Mouse
Application image: H00006667-M02-3-46-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to SP1 on formalin-fixed paraffin-embedded human endometrium. [antibody concentration 1 ug/ml]
Applications: WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SP1 monoclonal antibody (M02), clone 1A5 now

Add to cart