Brand: | Abnova |
Reference: | H00006666-M10 |
Product name: | SOX12 monoclonal antibody (M10), clone 4A9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SOX12. |
Clone: | 4A9 |
Isotype: | IgG2a Kappa |
Gene id: | 6666 |
Gene name: | SOX12 |
Gene alias: | SOX22 |
Gene description: | SRY (sex determining region Y)-box 12 |
Genbank accession: | NM_006943 |
Immunogen: | SOX12 (NP_008874, 252 a.a. ~ 313 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | LGFLSRLPPGPAGLDCSALDRDPDLQPPSGTSHFEFPDYCTPEVTEMIAGDWRPSSIADLVF |
Protein accession: | NP_008874 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (32.56 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged SOX12 is 0.1 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |