SOX12 monoclonal antibody (M08), clone 4A7 View larger

SOX12 monoclonal antibody (M08), clone 4A7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SOX12 monoclonal antibody (M08), clone 4A7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about SOX12 monoclonal antibody (M08), clone 4A7

Brand: Abnova
Reference: H00006666-M08
Product name: SOX12 monoclonal antibody (M08), clone 4A7
Product description: Mouse monoclonal antibody raised against a partial recombinant SOX12.
Clone: 4A7
Isotype: IgG2a Kappa
Gene id: 6666
Gene name: SOX12
Gene alias: SOX22
Gene description: SRY (sex determining region Y)-box 12
Genbank accession: NM_006943
Immunogen: SOX12 (NP_008874, 252 a.a. ~ 313 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LGFLSRLPPGPAGLDCSALDRDPDLQPPSGTSHFEFPDYCTPEVTEMIAGDWRPSSIADLVF
Protein accession: NP_008874
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006666-M08-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (32.56 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006666-M08-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged SOX12 is 0.1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy SOX12 monoclonal antibody (M08), clone 4A7 now

Add to cart