SOX10 monoclonal antibody (M01), clone 1E6 View larger

SOX10 monoclonal antibody (M01), clone 1E6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SOX10 monoclonal antibody (M01), clone 1E6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,ELISA,WB-Re

More info about SOX10 monoclonal antibody (M01), clone 1E6

Brand: Abnova
Reference: H00006663-M01
Product name: SOX10 monoclonal antibody (M01), clone 1E6
Product description: Mouse monoclonal antibody raised against a partial recombinant SOX10.
Clone: 1E6
Isotype: IgG2a Kappa
Gene id: 6663
Gene name: SOX10
Gene alias: DOM|MGC15649|WS2E|WS4
Gene description: SRY (sex determining region Y)-box 10
Genbank accession: NM_006941
Immunogen: SOX10 (NP_008872, 336 a.a. ~ 433 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: KPPGVALPTVSPPGVDAKAQVKTETAGPQGPPHYTDQPSTSQIAYTSLSLPHYGSAFPSISRPQFDYSDHQPSGPYYGHSGQASGLYSAFSYMGPSQR
Protein accession: NP_008872
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006663-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.52 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006663-M01-3-7-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to SOX10 on formalin-fixed paraffin-embedded human colon. [antibody concentration 1.5 ug/ml]
Applications: IHC-P,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Histopathological study of the treatment of melasma lesions using a low-fluence Q-switched 1064-nm neodymium:yttrium-aluminium-garnet laser.Kim JE, Chang SE, Yeo UC, Haw S, Kim IH
Clin Exp Dermatol. 2013 Mar;38(2):167-71. doi: 10.1111/j.1365-2230.2012.04473.x.

Reviews

Buy SOX10 monoclonal antibody (M01), clone 1E6 now

Add to cart