SOX5 monoclonal antibody (M01), clone 4H8 View larger

SOX5 monoclonal antibody (M01), clone 4H8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SOX5 monoclonal antibody (M01), clone 4H8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about SOX5 monoclonal antibody (M01), clone 4H8

Brand: Abnova
Reference: H00006660-M01
Product name: SOX5 monoclonal antibody (M01), clone 4H8
Product description: Mouse monoclonal antibody raised against a partial recombinant SOX5.
Clone: 4H8
Isotype: IgG2b Kappa
Gene id: 6660
Gene name: SOX5
Gene alias: L-SOX5|MGC35153
Gene description: SRY (sex determining region Y)-box 5
Genbank accession: NM_006940
Immunogen: SOX5 (NP_008871.3, 181 a.a. ~ 230 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GSGNFGEIKGTPESLAEKERQLMGMINQLTSLREQLLAAHDEQKKLAASQ
Protein accession: NP_008871.3
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006660-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (31.24 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006660-M01-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged SOX5 is 1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SOX5 monoclonal antibody (M01), clone 4H8 now

Add to cart