SOX4 monoclonal antibody (M02), clone 1E5 View larger

SOX4 monoclonal antibody (M02), clone 1E5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SOX4 monoclonal antibody (M02), clone 1E5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about SOX4 monoclonal antibody (M02), clone 1E5

Brand: Abnova
Reference: H00006659-M02
Product name: SOX4 monoclonal antibody (M02), clone 1E5
Product description: Mouse monoclonal antibody raised against a partial recombinant SOX4.
Clone: 1E5
Isotype: IgG1 Kappa
Gene id: 6659
Gene name: SOX4
Gene alias: EVI16
Gene description: SRY (sex determining region Y)-box 4
Genbank accession: NM_003107
Immunogen: SOX4 (NP_003098, 45 a.a. ~ 136 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: KADDPSWCKTPSGHIKRPMNAFMVWSQIERRKIMEQSPDMHNAEISKRLGKRWKLLKDSDKIPFIREAERLRLKHMADYPDYKYRPRKKVKS
Protein accession: NP_003098
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006659-M02-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged SOX4 is 0.03 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy SOX4 monoclonal antibody (M02), clone 1E5 now

Add to cart