SOX4 monoclonal antibody (M01A), clone 2C5 View larger

SOX4 monoclonal antibody (M01A), clone 2C5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SOX4 monoclonal antibody (M01A), clone 2C5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA

More info about SOX4 monoclonal antibody (M01A), clone 2C5

Brand: Abnova
Reference: H00006659-M01A
Product name: SOX4 monoclonal antibody (M01A), clone 2C5
Product description: Mouse monoclonal antibody raised against a partial recombinant SOX4.
Clone: 2C5
Isotype: IgG1 Kappa
Gene id: 6659
Gene name: SOX4
Gene alias: EVI16
Gene description: SRY (sex determining region Y)-box 4
Genbank accession: NM_003107
Immunogen: SOX4 (NP_003098, 45 a.a. ~ 136 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: KADDPSWCKTPSGHIKRPMNAFMVWSQIERRKIMEQSPDMHNAEISKRLGKRWKLLKDSDKIPFIREAERLRLKHMADYPDYKYRPRKKVKS
Protein accession: NP_003098
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA
Shipping condition: Dry Ice

Reviews

Buy SOX4 monoclonal antibody (M01A), clone 2C5 now

Add to cart