Brand: | Abnova |
Reference: | H00006659-M01A |
Product name: | SOX4 monoclonal antibody (M01A), clone 2C5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SOX4. |
Clone: | 2C5 |
Isotype: | IgG1 Kappa |
Gene id: | 6659 |
Gene name: | SOX4 |
Gene alias: | EVI16 |
Gene description: | SRY (sex determining region Y)-box 4 |
Genbank accession: | NM_003107 |
Immunogen: | SOX4 (NP_003098, 45 a.a. ~ 136 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | KADDPSWCKTPSGHIKRPMNAFMVWSQIERRKIMEQSPDMHNAEISKRLGKRWKLLKDSDKIPFIREAERLRLKHMADYPDYKYRPRKKVKS |
Protein accession: | NP_003098 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |