SOS1 monoclonal antibody (M01), clone 4C1 View larger

SOS1 monoclonal antibody (M01), clone 4C1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SOS1 monoclonal antibody (M01), clone 4C1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,PLA-Ce

More info about SOS1 monoclonal antibody (M01), clone 4C1

Brand: Abnova
Reference: H00006654-M01
Product name: SOS1 monoclonal antibody (M01), clone 4C1
Product description: Mouse monoclonal antibody raised against a partial recombinant SOS1.
Clone: 4C1
Isotype: IgG2a Kappa
Gene id: 6654
Gene name: SOS1
Gene alias: GF1|GGF1|GINGF|HGF|NS4
Gene description: son of sevenless homolog 1 (Drosophila)
Genbank accession: NM_005633
Immunogen: SOS1 (NP_005624, 313 a.a. ~ 420 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SQLSKPGAALYLQSIGEGFKEAVQYVLPRLLLAPVYHCLHYFELLKQLEEKSEDQEDKECLKQAITALLNVQSGMEKICSKSLAKRRLSESACRFYSQQMKGKQLAIK
Protein accession: NP_005624
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006654-M01-57-201-1.jpg
Application image note: Proximity Ligation Analysis of protein-protein interactions between CRKL and SOS1. Huh7 cells were stained with anti-CRKL rabbit purified polyclonal 1:1200 and anti-SOS1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
Applications: S-ELISA,ELISA,PLA-Ce
Shipping condition: Dry Ice

Reviews

Buy SOS1 monoclonal antibody (M01), clone 4C1 now

Add to cart