SORL1 monoclonal antibody (M01), clone 3F2 View larger

SORL1 monoclonal antibody (M01), clone 3F2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SORL1 monoclonal antibody (M01), clone 3F2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about SORL1 monoclonal antibody (M01), clone 3F2

Brand: Abnova
Reference: H00006653-M01
Product name: SORL1 monoclonal antibody (M01), clone 3F2
Product description: Mouse monoclonal antibody raised against a partial recombinant SORL1.
Clone: 3F2
Isotype: IgG2b Kappa
Gene id: 6653
Gene name: SORL1
Gene alias: C11orf32|FLJ21930|FLJ39258|LR11|LRP9|SORLA|SorLA-1|gp250
Gene description: sortilin-related receptor, L(DLR class) A repeats-containing
Genbank accession: NM_003105
Immunogen: SORL1 (NP_003096, 82 a.a. ~ 181 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SAALQPEPIKVYGQVSLNDSHNQMVVHWAGEKSNVIVALARDSLALARPKSSDVYVSYDYGKSFKKISDKLNFGLGNRSEAVIAQFYHSPADNKRYIFAD
Protein accession: NP_003096
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006653-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006653-M01-9-18-1.jpg
Application image note: Detection limit for recombinant GST tagged SORL1 is approximately 3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SORL1 monoclonal antibody (M01), clone 3F2 now

Add to cart