SORD monoclonal antibody (M02), clone 2B8 View larger

SORD monoclonal antibody (M02), clone 2B8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SORD monoclonal antibody (M02), clone 2B8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about SORD monoclonal antibody (M02), clone 2B8

Brand: Abnova
Reference: H00006652-M02
Product name: SORD monoclonal antibody (M02), clone 2B8
Product description: Mouse monoclonal antibody raised against a partial recombinant SORD.
Clone: 2B8
Isotype: IgG1 Kappa
Gene id: 6652
Gene name: SORD
Gene alias: SORD1
Gene description: sorbitol dehydrogenase
Genbank accession: NM_003104
Immunogen: SORD (NP_003095, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MAAAAKPNNLSLVVHGPGDLRLENYPIPEPGPNEVLLRMHSVGICGSDVHYWEYGRIGNFIVKKPMVLGHEASGTVEKVGSSVKHLKPGDRVAIEPGAPRENDEFCKMGR
Protein accession: NP_003095
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006652-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006652-M02-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged SORD is approximately 0.1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SORD monoclonal antibody (M02), clone 2B8 now

Add to cart