SORD monoclonal antibody (M01), clone 4D3 View larger

SORD monoclonal antibody (M01), clone 4D3

H00006652-M01_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SORD monoclonal antibody (M01), clone 4D3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse,Rat
Host speciesMouse
ApplicationsWB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr

More info about SORD monoclonal antibody (M01), clone 4D3

Brand: Abnova
Reference: H00006652-M01
Product name: SORD monoclonal antibody (M01), clone 4D3
Product description: Mouse monoclonal antibody raised against a partial recombinant SORD.
Clone: 4D3
Isotype: IgG1 Kappa
Gene id: 6652
Gene name: SORD
Gene alias: SORD1
Gene description: sorbitol dehydrogenase
Genbank accession: NM_003104
Immunogen: SORD (NP_003095, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MAAAAKPNNLSLVVHGPGDLRLENYPIPEPGPNEVLLRMHSVGICGSDVHYWEYGRIGNFIVKKPMVLGHEASGTVEKVGSSVKHLKPGDRVAIEPGAPRENDEFCKMGR
Protein accession: NP_003095
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006652-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Mouse,Rat
Application image: H00006652-M01-1-25-1.jpg
Application image note: SORD monoclonal antibody (M01), clone 4D3 Western Blot analysis of SORD expression in Hela S3 NE ( Cat # L013V3 ).
Applications: WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice
Publications: Sorbitol dehydrogenase expression is regulated by androgens in the human prostate.Szabo Z, Hamalainen J, Loikkanen I, Moilanen AM, Hirvikoski P, Vaisanen T, Paavonen TK, Vaarala MH.
Oncol Rep. 2010 May;23(5):1233-9.

Reviews

Buy SORD monoclonal antibody (M01), clone 4D3 now

Add to cart