SOLH monoclonal antibody (M05), clone 4E2 View larger

SOLH monoclonal antibody (M05), clone 4E2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SOLH monoclonal antibody (M05), clone 4E2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA

More info about SOLH monoclonal antibody (M05), clone 4E2

Brand: Abnova
Reference: H00006650-M05
Product name: SOLH monoclonal antibody (M05), clone 4E2
Product description: Mouse monoclonal antibody raised against a partial recombinant SOLH.
Clone: 4E2
Isotype: IgG2a Kappa
Gene id: 6650
Gene name: SOLH
Gene alias: CAPN15|MGC131491
Gene description: small optic lobes homolog (Drosophila)
Genbank accession: NM_005632
Immunogen: SOLH (NP_005623, 993 a.a. ~ 1086 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: HPKAYLHVQCDCTDSFNVVSTRGSLRTQDSVPPLHRQVLVILSQLEGNAGFSITHRLAHRKAAQAFLSDWTASKGTHSPPLTPEVAGLHGPRPL
Protein accession: NP_005623
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006650-M05-9-18-1.jpg
Application image note: Detection limit for recombinant GST tagged SOLH is 3 ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy SOLH monoclonal antibody (M05), clone 4E2 now

Add to cart