Brand: | Abnova |
Reference: | H00006650-M05 |
Product name: | SOLH monoclonal antibody (M05), clone 4E2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SOLH. |
Clone: | 4E2 |
Isotype: | IgG2a Kappa |
Gene id: | 6650 |
Gene name: | SOLH |
Gene alias: | CAPN15|MGC131491 |
Gene description: | small optic lobes homolog (Drosophila) |
Genbank accession: | NM_005632 |
Immunogen: | SOLH (NP_005623, 993 a.a. ~ 1086 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | HPKAYLHVQCDCTDSFNVVSTRGSLRTQDSVPPLHRQVLVILSQLEGNAGFSITHRLAHRKAAQAFLSDWTASKGTHSPPLTPEVAGLHGPRPL |
Protein accession: | NP_005623 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged SOLH is 3 ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA |
Shipping condition: | Dry Ice |