SOD1 monoclonal antibody (M04), clone 10D5 View larger

SOD1 monoclonal antibody (M04), clone 10D5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SOD1 monoclonal antibody (M04), clone 10D5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re,WB-Tr

More info about SOD1 monoclonal antibody (M04), clone 10D5

Brand: Abnova
Reference: H00006647-M04
Product name: SOD1 monoclonal antibody (M04), clone 10D5
Product description: Mouse monoclonal antibody raised against a full-length recombinant SOD1.
Clone: 10D5
Isotype: IgG2a Kappa
Gene id: 6647
Gene name: SOD1
Gene alias: ALS|ALS1|IPOA|SOD|homodimer
Gene description: superoxide dismutase 1, soluble
Genbank accession: BC001034
Immunogen: SOD1 (AAH01034, 1 a.a. ~ 154 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHCITGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ
Protein accession: AAH01034
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006647-M04-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (42.68 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006647-M04-13-15-1.jpg
Application image note: Western Blot analysis of SOD1 expression in transfected 293T cell line by SOD1 monoclonal antibody (M04), clone 10D5.

Lane 1: SOD1 transfected lysate (Predicted MW: 15.9 KDa).
Lane 2: Non-transfected lysate.
Applications: IF,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy SOD1 monoclonal antibody (M04), clone 10D5 now

Add to cart