Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IF,S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00006647-M04 |
Product name: | SOD1 monoclonal antibody (M04), clone 10D5 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant SOD1. |
Clone: | 10D5 |
Isotype: | IgG2a Kappa |
Gene id: | 6647 |
Gene name: | SOD1 |
Gene alias: | ALS|ALS1|IPOA|SOD|homodimer |
Gene description: | superoxide dismutase 1, soluble |
Genbank accession: | BC001034 |
Immunogen: | SOD1 (AAH01034, 1 a.a. ~ 154 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHCITGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ |
Protein accession: | AAH01034 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (42.68 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of SOD1 expression in transfected 293T cell line by SOD1 monoclonal antibody (M04), clone 10D5. Lane 1: SOD1 transfected lysate (Predicted MW: 15.9 KDa). Lane 2: Non-transfected lysate. |
Applications: | IF,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |