SNX1 monoclonal antibody (M01), clone 6H1 View larger

SNX1 monoclonal antibody (M01), clone 6H1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SNX1 monoclonal antibody (M01), clone 6H1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab

More info about SNX1 monoclonal antibody (M01), clone 6H1

Brand: Abnova
Reference: H00006642-M01
Product name: SNX1 monoclonal antibody (M01), clone 6H1
Product description: Mouse monoclonal antibody raised against a partial recombinant SNX1.
Clone: 6H1
Isotype: IgG2a Kappa
Gene id: 6642
Gene name: SNX1
Gene alias: HsT17379|MGC8664|SNX1A|Vps5
Gene description: sorting nexin 1
Genbank accession: NM_003099
Immunogen: SNX1 (NP_003090, 166 a.a. ~ 275 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: KVTTQTSLPLFRSKQFAVKRRFSDFLGLYEKLSEKHSQNGFIVPPPPEKSLIGMTKVKVGKEDSSSAEFLEKRRAALERYLQRIVNHPTMLQDPDVREFLEKEELPRAVG
Protein accession: NP_003090
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006642-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006642-M01-3-5-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to SNX1 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml]
Applications: WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab
Shipping condition: Dry Ice

Reviews

Buy SNX1 monoclonal antibody (M01), clone 6H1 now

Add to cart