SNRPG monoclonal antibody (M01), clone 2H8-1C12 View larger

SNRPG monoclonal antibody (M01), clone 2H8-1C12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SNRPG monoclonal antibody (M01), clone 2H8-1C12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re,WB-Tr

More info about SNRPG monoclonal antibody (M01), clone 2H8-1C12

Brand: Abnova
Reference: H00006637-M01
Product name: SNRPG monoclonal antibody (M01), clone 2H8-1C12
Product description: Mouse monoclonal antibody raised against a full length recombinant SNRPG.
Clone: 2H8-1C12
Isotype: IgG1 Kappa
Gene id: 6637
Gene name: SNRPG
Gene alias: MGC117317|SMG
Gene description: small nuclear ribonucleoprotein polypeptide G
Genbank accession: BC000070
Immunogen: SNRPG (AAH00070, 1 a.a. ~ 76 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIMLEALERV
Protein accession: AAH00070
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006637-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (34.1 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006637-M01-1-25-1.jpg
Application image note: SNRPG monoclonal antibody (M01), clone 2H8-1C12 Western Blot analysis of SNRPG expression in Hela S3 NE ( Cat # L013V3 ).
Applications: WB-Ce,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy SNRPG monoclonal antibody (M01), clone 2H8-1C12 now

Add to cart