Brand: | Abnova |
Reference: | H00006637-M01 |
Product name: | SNRPG monoclonal antibody (M01), clone 2H8-1C12 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant SNRPG. |
Clone: | 2H8-1C12 |
Isotype: | IgG1 Kappa |
Gene id: | 6637 |
Gene name: | SNRPG |
Gene alias: | MGC117317|SMG |
Gene description: | small nuclear ribonucleoprotein polypeptide G |
Genbank accession: | BC000070 |
Immunogen: | SNRPG (AAH00070, 1 a.a. ~ 76 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIMLEALERV |
Protein accession: | AAH00070 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (34.1 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | SNRPG monoclonal antibody (M01), clone 2H8-1C12 Western Blot analysis of SNRPG expression in Hela S3 NE ( Cat # L013V3 ). |
Applications: | WB-Ce,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |