SNRPD1 (Human) Recombinant Protein (P01) View larger

SNRPD1 (Human) Recombinant Protein (P01)

New product

374,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SNRPD1 (Human) Recombinant Protein (P01)

BrandAbnova
Product typeProteins
ApplicationsAP,Array,ELISA,WB-Re

More info about SNRPD1 (Human) Recombinant Protein (P01)

Brand: Abnova
Reference: H00006632-P01
Product name: SNRPD1 (Human) Recombinant Protein (P01)
Product description: Human SNRPD1 full-length ORF (NP_008869.1, 1 a.a. - 119 a.a.) recombinant protein with GST tag at N-terminal.
Gene id: 6632
Gene name: SNRPD1
Gene alias: HsT2456|SMD1|SNRPD
Gene description: small nuclear ribonucleoprotein D1 polypeptide 16kDa
Genbank accession: NM_006938.2
Immunogen sequence/protein sequence: MKLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFILPDSLPLDTLLVDVEPKVKSKKREAVAGRGRGRGRGRGRGRGRGRGGPRR
Protein accession: NP_008869.1
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue
Quality control testing picture: qc_test-H00006632-P01-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SNRPD1 (Human) Recombinant Protein (P01) now

Add to cart