SNRPB2 monoclonal antibody (M01), clone 2F4 View larger

SNRPB2 monoclonal antibody (M01), clone 2F4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SNRPB2 monoclonal antibody (M01), clone 2F4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about SNRPB2 monoclonal antibody (M01), clone 2F4

Brand: Abnova
Reference: H00006629-M01
Product name: SNRPB2 monoclonal antibody (M01), clone 2F4
Product description: Mouse monoclonal antibody raised against a full-length recombinant SNRPB2.
Clone: 2F4
Isotype: IgG2a Kappa
Gene id: 6629
Gene name: SNRPB2
Gene alias: MGC24807|MGC45309
Gene description: small nuclear ribonucleoprotein polypeptide B''
Genbank accession: BC036737
Immunogen: SNRPB2 (AAH36737, 1 a.a. ~ 225 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MDIRPNHTIYINNMNDKIKKEELKRSLYALFSQFGHVVDIVALKTMKMRGQAFVIFKELGSSTNALRQLQGFPFYGKPMRIQYAKTDSDIISKMRGTFADKEKKKEKKKAKTVEQTATTTNKKPGQGTPNSANTQGNSTPNPQVPDYPPNYILFLNNLPEETNEMMLSMLFNQFPGFKEVRLVPGRHDIAFVEFENDGQAGAARDALQGFKITPSHAMKITYAKK
Protein accession: AAH36737
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006629-M01-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged SNRPB2 is 1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy SNRPB2 monoclonal antibody (M01), clone 2F4 now

Add to cart