SNRPB monoclonal antibody (M01A), clone 1B4 View larger

SNRPB monoclonal antibody (M01A), clone 1B4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SNRPB monoclonal antibody (M01A), clone 1B4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA

More info about SNRPB monoclonal antibody (M01A), clone 1B4

Brand: Abnova
Reference: H00006628-M01A
Product name: SNRPB monoclonal antibody (M01A), clone 1B4
Product description: Mouse monoclonal antibody raised against a partial recombinant SNRPB.
Clone: 1B4
Isotype: IgG1 Kappa
Gene id: 6628
Gene name: SNRPB
Gene alias: COD|SNRPB1|SmB/SmB'|snRNP-B
Gene description: small nuclear ribonucleoprotein polypeptides B and B1
Genbank accession: NM_003091
Immunogen: SNRPB (NP_003082, 1 a.a. ~ 80 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSM
Protein accession: NP_003082
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA
Shipping condition: Dry Ice

Reviews

Buy SNRPB monoclonal antibody (M01A), clone 1B4 now

Add to cart