Brand: | Abnova |
Reference: | H00006628-M01 |
Product name: | SNRPB monoclonal antibody (M01), clone 1B4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SNRPB. |
Clone: | 1B4 |
Isotype: | IgG1 Kappa |
Gene id: | 6628 |
Gene name: | SNRPB |
Gene alias: | COD|SNRPB1|SmB/SmB'|snRNP-B |
Gene description: | small nuclear ribonucleoprotein polypeptides B and B1 |
Genbank accession: | NM_003091 |
Immunogen: | SNRPB (NP_003082, 1 a.a. ~ 80 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSM |
Protein accession: | NP_003082 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged SNRPB is 3 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |