Brand: | Abnova |
Reference: | H00006623-M01A |
Product name: | SNCG monoclonal antibody (M01A), clone 2C3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SNCG. |
Clone: | 2C3 |
Isotype: | IgG2a Kappa |
Gene id: | 6623 |
Gene name: | SNCG |
Gene alias: | BCSG1|SR |
Gene description: | synuclein, gamma (breast cancer-specific protein 1) |
Genbank accession: | BC014098 |
Immunogen: | SNCG (AAH14098, 21 a.a. ~ 127 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | KTKQGVTEAAEKTKEGVMYVGAKTKENVVQSVTSVAEKTKEQANAVSEAVVSSVNTVATKTVEEAENIAVTSGVVRKEDLRPSAPQQEGEASKEKEEVAEEAQSGGD |
Protein accession: | AAH14098 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.4 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | SNCG monoclonal antibody (M01A), clone 2C3. Western Blot analysis of SNCG expression in human spleen. |
Applications: | WB-Ti,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |