SNCG monoclonal antibody (M01A), clone 2C3 View larger

SNCG monoclonal antibody (M01A), clone 2C3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SNCG monoclonal antibody (M01A), clone 2C3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,ELISA,WB-Re,WB-Tr

More info about SNCG monoclonal antibody (M01A), clone 2C3

Brand: Abnova
Reference: H00006623-M01A
Product name: SNCG monoclonal antibody (M01A), clone 2C3
Product description: Mouse monoclonal antibody raised against a partial recombinant SNCG.
Clone: 2C3
Isotype: IgG2a Kappa
Gene id: 6623
Gene name: SNCG
Gene alias: BCSG1|SR
Gene description: synuclein, gamma (breast cancer-specific protein 1)
Genbank accession: BC014098
Immunogen: SNCG (AAH14098, 21 a.a. ~ 127 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: KTKQGVTEAAEKTKEGVMYVGAKTKENVVQSVTSVAEKTKEQANAVSEAVVSSVNTVATKTVEEAENIAVTSGVVRKEDLRPSAPQQEGEASKEKEEVAEEAQSGGD
Protein accession: AAH14098
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006623-M01A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.4 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006623-M01A-2-A4-1.jpg
Application image note: SNCG monoclonal antibody (M01A), clone 2C3. Western Blot analysis of SNCG expression in human spleen.
Applications: WB-Ti,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy SNCG monoclonal antibody (M01A), clone 2C3 now

Add to cart