SNCG monoclonal antibody (M01), clone 2C3 View larger

SNCG monoclonal antibody (M01), clone 2C3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SNCG monoclonal antibody (M01), clone 2C3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,ELISA,WB-Re,WB-Tr

More info about SNCG monoclonal antibody (M01), clone 2C3

Brand: Abnova
Reference: H00006623-M01
Product name: SNCG monoclonal antibody (M01), clone 2C3
Product description: Mouse monoclonal antibody raised against a partial recombinant SNCG.
Clone: 2C3
Isotype: IgG2a Kappa
Gene id: 6623
Gene name: SNCG
Gene alias: BCSG1|SR
Gene description: synuclein, gamma (breast cancer-specific protein 1)
Genbank accession: BC014098
Immunogen: SNCG (AAH14098, 21 a.a. ~ 127 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: KTKQGVTEAAEKTKEGVMYVGAKTKENVVQSVTSVAEKTKEQANAVSEAVVSSVNTVATKTVEEAENIAVTSGVVRKEDLRPSAPQQEGEASKEKEEVAEEAQSGGD
Protein accession: AAH14098
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006623-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.4 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006623-M01-13-15-1.jpg
Application image note: Western Blot analysis of SNCG expression in transfected 293T cell line by SNCG monoclonal antibody (M01), clone 2C3.

Lane 1: SNCG transfected lysate(13.3 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ti,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice
Publications: Adoptive transfer of immune cells from glaucomatous mice provokes retinal ganglion cell loss in recipients.Gramlich OW, Ding QJ, Zhu W, Cook A, Anderson MG, Kuehn MH.
Acta Neuropathol Commun. 2015 Sep 15;3:56

Reviews

Buy SNCG monoclonal antibody (M01), clone 2C3 now

Add to cart