SNAPC4 monoclonal antibody (M07), clone 3F10 View larger

SNAPC4 monoclonal antibody (M07), clone 3F10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SNAPC4 monoclonal antibody (M07), clone 3F10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re

More info about SNAPC4 monoclonal antibody (M07), clone 3F10

Brand: Abnova
Reference: H00006621-M07
Product name: SNAPC4 monoclonal antibody (M07), clone 3F10
Product description: Mouse monoclonal antibody raised against a partial recombinant SNAPC4.
Clone: 3F10
Isotype: IgG2a Kappa
Gene id: 6621
Gene name: SNAPC4
Gene alias: FLJ13451|PTFalpha|SNAP190
Gene description: small nuclear RNA activating complex, polypeptide 4, 190kDa
Genbank accession: NM_003086
Immunogen: SNAPC4 (NP_003077, 53 a.a. ~ 162 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: PADPPISEEERWGEASNDEDDPKDKTLPEDPETCLQLNMVYQEVIQEKLAEANLLLAQNREQQEELMRDLAGSKGTKVKDGKSLPPSTYMGHFMKPYFKDKVTGVGPPAN
Protein accession: NP_003077
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006621-M07-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006621-M07-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged SNAPC4 is 0.1 ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SNAPC4 monoclonal antibody (M07), clone 3F10 now

Add to cart