SNAPC4 monoclonal antibody (M04), clone 4G5 View larger

SNAPC4 monoclonal antibody (M04), clone 4G5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SNAPC4 monoclonal antibody (M04), clone 4G5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about SNAPC4 monoclonal antibody (M04), clone 4G5

Brand: Abnova
Reference: H00006621-M04
Product name: SNAPC4 monoclonal antibody (M04), clone 4G5
Product description: Mouse monoclonal antibody raised against a partial recombinant SNAPC4.
Clone: 4G5
Isotype: IgG1 Kappa
Gene id: 6621
Gene name: SNAPC4
Gene alias: FLJ13451|PTFalpha|SNAP190
Gene description: small nuclear RNA activating complex, polypeptide 4, 190kDa
Genbank accession: NM_003086
Immunogen: SNAPC4 (NP_003077, 53 a.a. ~ 162 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: PADPPISEEERWGEASNDEDDPKDKTLPEDPETCLQLNMVYQEVIQEKLAEANLLLAQNREQQEELMRDLAGSKGTKVKDGKSLPPSTYMGHFMKPYFKDKVTGVGPPAN
Protein accession: NP_003077
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006621-M04-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006621-M04-1-12-1.jpg
Application image note: SNAPC4 monoclonal antibody (M04), clone 4G5 Western Blot analysis of SNAPC4 expression in HepG2 ( Cat # L019V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SNAPC4 monoclonal antibody (M04), clone 4G5 now

Add to cart