SNCB monoclonal antibody (M16), clone 4F11 View larger

SNCB monoclonal antibody (M16), clone 4F11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SNCB monoclonal antibody (M16), clone 4F11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about SNCB monoclonal antibody (M16), clone 4F11

Brand: Abnova
Reference: H00006620-M16
Product name: SNCB monoclonal antibody (M16), clone 4F11
Product description: Mouse monoclonal antibody raised against a partial recombinant SNCB.
Clone: 4F11
Isotype: IgG2a Kappa
Gene id: 6620
Gene name: SNCB
Gene alias: -
Gene description: synuclein, beta
Genbank accession: NM_001001502
Immunogen: SNCB (NP_001001502.1, 1 a.a. ~ 65 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MDVFMKGLSMAKEGVVAAAEKTKQGVTEAAEKTKEGVLYVGSKTREGVVQGVASVAEKTKEQASH
Protein accession: NP_001001502.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006620-M16-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (32.89 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006620-M16-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged SNCB is approximately 1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SNCB monoclonal antibody (M16), clone 4F11 now

Add to cart