SNCB monoclonal antibody (M07), clone 3H4 View larger

SNCB monoclonal antibody (M07), clone 3H4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SNCB monoclonal antibody (M07), clone 3H4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about SNCB monoclonal antibody (M07), clone 3H4

Brand: Abnova
Reference: H00006620-M07
Product name: SNCB monoclonal antibody (M07), clone 3H4
Product description: Mouse monoclonal antibody raised against a full-length recombinant SNCB.
Clone: 3H4
Isotype: IgG2a Kappa
Gene id: 6620
Gene name: SNCB
Gene alias: -
Gene description: synuclein, beta
Genbank accession: BC002902
Immunogen: SNCB (AAH02902, 1 a.a. ~ 134 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MDVFMKGLSMAKEGVVAAAEKTKQGVTEAAEKTKEGVLYVGSKTREGVVQGVASVAEKTKEQASHLGGAVFSGAGNIAAATGLVKREEFPTDLKPEEVAQEAAEEPLIEPLMEPEGESYEDPPQEEYQEYEPEA
Protein accession: AAH02902
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006620-M07-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (40.48 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006620-M07-13-15-1.jpg
Application image note: Western Blot analysis of SNCB expression in transfected 293T cell line by SNCB monoclonal antibody (M07), clone 3H4.

Lane 1: SNCB transfected lysate(14.3 KDa).
Lane 2: Non-transfected lysate.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy SNCB monoclonal antibody (M07), clone 3H4 now

Add to cart