SNCB monoclonal antibody (M02), clone 3G6 View larger

SNCB monoclonal antibody (M02), clone 3G6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SNCB monoclonal antibody (M02), clone 3G6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re

More info about SNCB monoclonal antibody (M02), clone 3G6

Brand: Abnova
Reference: H00006620-M02
Product name: SNCB monoclonal antibody (M02), clone 3G6
Product description: Mouse monoclonal antibody raised against a full-length recombinant SNCB.
Clone: 3G6
Isotype: IgG2a Kappa
Gene id: 6620
Gene name: SNCB
Gene alias: -
Gene description: synuclein, beta
Genbank accession: BC002902
Immunogen: SNCB (AAH02902, 1 a.a. ~ 134 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MDVFMKGLSMAKEGVVAAAEKTKQGVTEAAEKTKEGVLYVGSKTREGVVQGVASVAEKTKEQASHLGGAVFSGAGNIAAATGLVKREEFPTDLKPEEVAQEAAEEPLIEPLMEPEGESYEDPPQEEYQEYEPEA
Protein accession: AAH02902
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006620-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (40.48 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006620-M02-9-18-1.jpg
Application image note: Detection limit for recombinant GST tagged SNCB is approximately 3ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SNCB monoclonal antibody (M02), clone 3G6 now

Add to cart