SNAP25 monoclonal antibody (M01), clone 4A3 View larger

SNAP25 monoclonal antibody (M01), clone 4A3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SNAP25 monoclonal antibody (M01), clone 4A3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about SNAP25 monoclonal antibody (M01), clone 4A3

Brand: Abnova
Reference: H00006616-M01
Product name: SNAP25 monoclonal antibody (M01), clone 4A3
Product description: Mouse monoclonal antibody raised against a partial recombinant SNAP25.
Clone: 4A3
Isotype: IgG1 Kappa
Gene id: 6616
Gene name: SNAP25
Gene alias: FLJ23079|RIC-4|RIC4|SEC9|SNAP|SNAP-25|bA416N4.2|dJ1068F16.2
Gene description: synaptosomal-associated protein, 25kDa
Genbank accession: BC010647
Immunogen: SNAP25 (AAH10647, 31 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: RMLQLVEESKDAGIRTLVMLDEQGEQLDRVEEGMNHINQDMKEAEKNLKDLGKCCGLFICPCNKLKSSDAYKKAWGNNQDGVVASQPARVVDEREQMAIS
Protein accession: AAH10647
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006616-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006616-M01-13-15-1.jpg
Application image note: Western Blot analysis of SNAP25 expression in transfected 293T cell line by SNAP25 monoclonal antibody (M01), clone 4A3.

Lane 1: SNAP25 transfected lysate(23.315 KDa).
Lane 2: Non-transfected lysate.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy SNAP25 monoclonal antibody (M01), clone 4A3 now

Add to cart