Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00006616-M01 |
Product name: | SNAP25 monoclonal antibody (M01), clone 4A3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SNAP25. |
Clone: | 4A3 |
Isotype: | IgG1 Kappa |
Gene id: | 6616 |
Gene name: | SNAP25 |
Gene alias: | FLJ23079|RIC-4|RIC4|SEC9|SNAP|SNAP-25|bA416N4.2|dJ1068F16.2 |
Gene description: | synaptosomal-associated protein, 25kDa |
Genbank accession: | BC010647 |
Immunogen: | SNAP25 (AAH10647, 31 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | RMLQLVEESKDAGIRTLVMLDEQGEQLDRVEEGMNHINQDMKEAEKNLKDLGKCCGLFICPCNKLKSSDAYKKAWGNNQDGVVASQPARVVDEREQMAIS |
Protein accession: | AAH10647 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of SNAP25 expression in transfected 293T cell line by SNAP25 monoclonal antibody (M01), clone 4A3. Lane 1: SNAP25 transfected lysate(23.315 KDa). Lane 2: Non-transfected lysate. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |