SNAI1 monoclonal antibody (M41), clone 1A5 View larger

SNAI1 monoclonal antibody (M41), clone 1A5

H00006615-M41_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SNAI1 monoclonal antibody (M41), clone 1A5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Tr,IP

More info about SNAI1 monoclonal antibody (M41), clone 1A5

Brand: Abnova
Reference: H00006615-M41
Product name: SNAI1 monoclonal antibody (M41), clone 1A5
Product description: Mouse monoclonal antibody raised against a partial recombinant SNAI1.
Clone: 1A5
Isotype: IgG1 Kappa
Gene id: 6615
Gene name: SNAI1
Gene alias: SLUGH2|SNA|SNAH|dJ710H13.1
Gene description: snail homolog 1 (Drosophila)
Genbank accession: NM_005985
Immunogen: SNAI1 (NP_005976.2, 121 a.a. ~ 230 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LEAEAYAAFPGLGQVPKQLAQLSEAKDLQARKAFNCKYCNKEYLSLGALKMHIRSHTLPCVCGTCGKAFSRPWLLQGHVRTHTGEKPFSCPHCSRAFADRSNLRAHLQTH
Protein accession: NP_005976.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006615-M41-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged SNAI1 is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Tr,IP
Shipping condition: Dry Ice

Reviews

Buy SNAI1 monoclonal antibody (M41), clone 1A5 now

Add to cart