SNAI1 monoclonal antibody (M10), clone 2G11 View larger

SNAI1 monoclonal antibody (M10), clone 2G11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SNAI1 monoclonal antibody (M10), clone 2G11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re,IF-CTC

More info about SNAI1 monoclonal antibody (M10), clone 2G11

Brand: Abnova
Reference: H00006615-M10
Product name: SNAI1 monoclonal antibody (M10), clone 2G11
Product description: Mouse monoclonal antibody raised against a partial recombinant SNAI1.
Clone: 2G11
Isotype: IgG2b Kappa
Gene id: 6615
Gene name: SNAI1
Gene alias: SLUGH2|SNA|SNAH|dJ710H13.1
Gene description: snail homolog 1 (Drosophila)
Genbank accession: NM_005985
Immunogen: SNAI1 (NP_005976.2, 121 a.a. ~ 230 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LEAEAYAAFPGLGQVPKQLAQLSEAKDLQARKAFNCKYCNKEYLSLGALKMHIRSHTLPCVCGTCGKAFSRPWLLQGHVRTHTGEKPFSCPHCSRAFADRSNLRAHLQTH
Protein accession: NP_005976.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006615-M10-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.73 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006615-M10-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged SNAI1 is approximately 0.3ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA,WB-Re,IF-CTC
Shipping condition: Dry Ice
Publications: Isolation and characterization of a population of stem-like progenitor cells from an atypical meningioma.Rath P, Miller DC, Litofsky NS, Anthony DC, Feng Q, Franklin C, Pei L, Free A, Liu J, Ren M, Kirk MD, Shi H.
Exp Mol Pathol. 2010 Dec 17. [Epub ahead of print]

Reviews

Buy SNAI1 monoclonal antibody (M10), clone 2G11 now

Add to cart