SUMO2 monoclonal antibody (M06), clone 2H8 View larger

SUMO2 monoclonal antibody (M06), clone 2H8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SUMO2 monoclonal antibody (M06), clone 2H8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,ELISA,WB-Re,WB-Tr

More info about SUMO2 monoclonal antibody (M06), clone 2H8

Brand: Abnova
Reference: H00006613-M06
Product name: SUMO2 monoclonal antibody (M06), clone 2H8
Product description: Mouse monoclonal antibody raised against a full-length recombinant SUMO2.
Clone: 2H8
Isotype: IgG1 Kappa
Gene id: 6613
Gene name: SUMO2
Gene alias: HSMT3|MGC117191|SMT3B|SMT3H2
Gene description: SMT3 suppressor of mif two 3 homolog 2 (S. cerevisiae)
Genbank accession: BC008450
Immunogen: SUMO2 (AAH08450, 1 a.a. ~ 95 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MADEKPKEGVKTENNNHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY
Protein accession: AAH08450
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006613-M06-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.19 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006613-M06-13-15-1.jpg
Application image note: Western Blot analysis of SUMO2 expression in transfected 293T cell line by SUMO2 monoclonal antibody (M06), clone 2H8.

Lane 1: SUMO2 transfected lysate(10.9 KDa).
Lane 2: Non-transfected lysate.
Applications: IHC-P,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy SUMO2 monoclonal antibody (M06), clone 2H8 now

Add to cart