SUMO2 monoclonal antibody (M02), clone 2C7-1A11 View larger

SUMO2 monoclonal antibody (M02), clone 2C7-1A11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SUMO2 monoclonal antibody (M02), clone 2C7-1A11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about SUMO2 monoclonal antibody (M02), clone 2C7-1A11

Brand: Abnova
Reference: H00006613-M02
Product name: SUMO2 monoclonal antibody (M02), clone 2C7-1A11
Product description: Mouse monoclonal antibody raised against a full-length recombinant SUMO2.
Clone: 2C7-1A11
Isotype: IgG1 Kappa
Gene id: 6613
Gene name: SUMO2
Gene alias: HSMT3|MGC117191|SMT3B|SMT3H2
Gene description: SMT3 suppressor of mif two 3 homolog 2 (S. cerevisiae)
Genbank accession: BC008450
Immunogen: SUMO2 (AAH08450, 1 a.a. ~ 95 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MADEKPKEGVKTENNNHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY
Protein accession: AAH08450
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006613-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.19 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006613-M02-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged SUMO2 is 0.1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SUMO2 monoclonal antibody (M02), clone 2C7-1A11 now

Add to cart