SUMO3 monoclonal antibody (M08), clone 4G11 View larger

SUMO3 monoclonal antibody (M08), clone 4G11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SUMO3 monoclonal antibody (M08), clone 4G11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about SUMO3 monoclonal antibody (M08), clone 4G11

Brand: Abnova
Reference: H00006612-M08
Product name: SUMO3 monoclonal antibody (M08), clone 4G11
Product description: Mouse monoclonal antibody raised against a partial recombinant SUMO3.
Clone: 4G11
Isotype: IgG2a Kappa
Gene id: 6612
Gene name: SUMO3
Gene alias: SMT3A|SMT3H1|SUMO-3
Gene description: SMT3 suppressor of mif two 3 homolog 3 (S. cerevisiae)
Genbank accession: NM_006936
Immunogen: SUMO3 (NP_008867, 1 a.a. ~ 103 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MSEEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVPESSLAGHSF
Protein accession: NP_008867
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006612-M08-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.96 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006612-M08-13-15-1.jpg
Application image note: Western Blot analysis of SUMO3 expression in transfected 293T cell line by SUMO3 monoclonal antibody (M08), clone 4G11.

Lane 1: SUMO3 transfected lysate(11.6 KDa).
Lane 2: Non-transfected lysate.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy SUMO3 monoclonal antibody (M08), clone 4G11 now

Add to cart