SMS monoclonal antibody (M01), clone 1G6 View larger

SMS monoclonal antibody (M01), clone 1G6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SMS monoclonal antibody (M01), clone 1G6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about SMS monoclonal antibody (M01), clone 1G6

Brand: Abnova
Reference: H00006611-M01
Product name: SMS monoclonal antibody (M01), clone 1G6
Product description: Mouse monoclonal antibody raised against a full length recombinant SMS.
Clone: 1G6
Isotype: IgG2a kappa
Gene id: 6611
Gene name: SMS
Gene alias: MRSR|SPMSY|SRS|SpS
Gene description: spermine synthase
Genbank accession: BC009898
Immunogen: SMS (AAH09898.1, 1 a.a. ~ 366 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MAAARHSTLDFMLGAKADGETILKGLQSIFQEQGMAESVHTWQDHGYLATYTNKNGSFANLRIYPHGLVLLDLQSYDGDAQGKEEIDSILNKVEERMKELSQDSTGRVKRLPPIVRGGAIDRYWPTADGRLVEYDIDEVVYDEDSPYQNIKILHSKQFGNILILSGDVNLAESDLAYTRAIMGSGKEDYTGKDVLILGGGDGGILCEIVKLKPKMVTMVEIDQMVIDGCKKYMRKTCGDVLDNLKGDCYQVLIEDCIPVLKRYAKEGREFDYVINDLTAVPISTSPEEDSTWEFLRLILDLSMKVLKQDGKYFTQGNCVNLTEALSLYEEQLGRLYCPVEFSKEIVCVPSYLELWVFYTVWKKAKP
Protein accession: AAH09898.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006611-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (66 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006611-M01-13-15-1.jpg
Application image note: Western Blot analysis of SMS expression in transfected 293T cell line by SMS monoclonal antibody (M01), clone 1G6.

Lane 1: SMS transfected lysate(41.268 KDa).
Lane 2: Non-transfected lysate.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice
Publications: A Y328C missense mutation in spermine synthase causes a mild form of Snyder-Robinson syndrome.Zhang Z, Norris J, Kalscheuer V, Wood T, Wang L, Schwartz C, Alexov E, Van Esch H
Hum Mol Genet. 2013 May 31.

Reviews

Buy SMS monoclonal antibody (M01), clone 1G6 now

Add to cart