SMO monoclonal antibody (M07), clone 2F8 View larger

SMO monoclonal antibody (M07), clone 2F8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SMO monoclonal antibody (M07), clone 2F8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about SMO monoclonal antibody (M07), clone 2F8

Brand: Abnova
Reference: H00006608-M07
Product name: SMO monoclonal antibody (M07), clone 2F8
Product description: Mouse monoclonal antibody raised against a partial recombinant SMO.
Clone: 2F8
Isotype: IgG1 Kappa
Gene id: 6608
Gene name: SMO
Gene alias: Gx|SMOH
Gene description: smoothened homolog (Drosophila)
Genbank accession: NM_005631
Immunogen: SMO (NP_005622, 56 a.a. ~ 155 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GPPPPLSHCGRAAPCEPLRYNVCLGSVLPYGATSTLLAGDSDSQEEAHGKLVLWSGLRNAPRCWAVIQPLLCAVYMPKCENDRVELPSRTLCQATRGPCA
Protein accession: NP_005622
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006608-M07-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged SMO is approximately 0.3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy SMO monoclonal antibody (M07), clone 2F8 now

Add to cart