SMO monoclonal antibody (M05A), clone 1G11 View larger

SMO monoclonal antibody (M05A), clone 1G11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SMO monoclonal antibody (M05A), clone 1G11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA

More info about SMO monoclonal antibody (M05A), clone 1G11

Brand: Abnova
Reference: H00006608-M05A
Product name: SMO monoclonal antibody (M05A), clone 1G11
Product description: Mouse monoclonal antibody raised against a partial recombinant SMO.
Clone: 1G11
Isotype: IgG1 Kappa
Gene id: 6608
Gene name: SMO
Gene alias: Gx|SMOH
Gene description: smoothened homolog (Drosophila)
Genbank accession: NM_005631
Immunogen: SMO (NP_005622, 56 a.a. ~ 155 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GPPPPLSHCGRAAPCEPLRYNVCLGSVLPYGATSTLLAGDSDSQEEAHGKLVLWSGLRNAPRCWAVIQPLLCAVYMPKCENDRVELPSRTLCQATRGPCA
Protein accession: NP_005622
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA
Shipping condition: Dry Ice

Reviews

Buy SMO monoclonal antibody (M05A), clone 1G11 now

Add to cart