SMN2 monoclonal antibody (M02), clone 1A3-2B9 View larger

SMN2 monoclonal antibody (M02), clone 1A3-2B9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SMN2 monoclonal antibody (M02), clone 1A3-2B9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re,WB-Tr

More info about SMN2 monoclonal antibody (M02), clone 1A3-2B9

Brand: Abnova
Reference: H00006607-M02
Product name: SMN2 monoclonal antibody (M02), clone 1A3-2B9
Product description: Mouse monoclonal antibody raised against a full-length recombinant SMN2.
Clone: 1A3-2B9
Isotype: IgG2a Kappa
Gene id: 6607
Gene name: SMN2
Gene alias: BCD541|C-BCD541|FLJ76644|MGC20996|MGC5208|SMNC
Gene description: survival of motor neuron 2, centromeric
Genbank accession: BC000908
Immunogen: SMN2 (AAH00908, 1 a.a. ~ 282 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MAMSSGGSGGGVPEQEDSVLFRRGTGQSDDSDIWDDTALIKAYDKAVASFKHALKNGDICETSGKPKTTPKRKPAKKNKSQKKNTAASLQQWKVGDKCSAIWSEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLSDLLSPICEVANNIEQNAQENENESQVSTDESENSRSPGNKSDNIKPKSAPWNSFLPPPPPMPGPRLGPGKPGLKFNGPPPPPPPPPPHLLSCWLPPFPSGPPIIPPPPPICPDSLDDADALGSMLISWYMSGYHTGYYMEMLA
Protein accession: AAH00908
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006607-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (56.76 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006607-M02-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged SMN2 is approximately 1ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy SMN2 monoclonal antibody (M02), clone 1A3-2B9 now

Add to cart