Brand: | Abnova |
Reference: | H00006607-B01P |
Product name: | SMN2 purified MaxPab mouse polyclonal antibody (B01P) |
Product description: | Mouse polyclonal antibody raised against a full-length human SMN2 protein. |
Gene id: | 6607 |
Gene name: | SMN2 |
Gene alias: | BCD541|C-BCD541|FLJ76644|MGC20996|MGC5208|SMNC |
Gene description: | survival of motor neuron 2, centromeric |
Genbank accession: | NM_022875.1 |
Immunogen: | SMN2 (NP_075013.1, 1 a.a. ~ 282 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MAMSSGGSGGGVPEQEDSVLFRRGTGQSDDSDIWDDTALIKAYDKAVASFKHALKNGDICETSGKPKTTPKRKPAKKNKSQKKNTAASLQQWKVGDKCSAIWSEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLSDLLSPICEVANNIEQNAQENENESQVSTDESENSRSPGNKSDNIKPKSAPWNSFLPPPPPMPGPRLGPGKPGLKFNGPPPPPPPPPPHLLSCWLPPFPSGPPIIPPPPPICPDSLDDADALGSMLISWYMSGYHTGYYMEMLA |
Protein accession: | NP_075013.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | SMN2 MaxPab polyclonal antibody. Western Blot analysis of SMN2 expression in human kidney. |
Applications: | WB-Ti,IF,WB-Tr |
Shipping condition: | Dry Ice |