SMARCE1 monoclonal antibody (M01), clone 6G11 View larger

SMARCE1 monoclonal antibody (M01), clone 6G11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SMARCE1 monoclonal antibody (M01), clone 6G11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re,IP

More info about SMARCE1 monoclonal antibody (M01), clone 6G11

Brand: Abnova
Reference: H00006605-M01
Product name: SMARCE1 monoclonal antibody (M01), clone 6G11
Product description: Mouse monoclonal antibody raised against a partial recombinant SMARCE1.
Clone: 6G11
Isotype: IgG1 Kappa
Gene id: 6605
Gene name: SMARCE1
Gene alias: BAF57
Gene description: SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily e, member 1
Genbank accession: NM_003079
Immunogen: SMARCE1 (NP_003070, 75 a.a. ~ 142 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: RYSRKVWDQVKASNPDLKLWEIGKIIGGMWRDLTDEEKQEYLNEYEAEKIEYNESMKAYHNSPAYLAY
Protein accession: NP_003070
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006605-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (33.22 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006605-M01-31-15-1.jpg
Application image note: Immunoprecipitation of SMARCE1 transfected lysate using anti-SMARCE1 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with SMARCE1 MaxPab rabbit polyclonal antibody.
Applications: ELISA,WB-Re,IP
Shipping condition: Dry Ice

Reviews

Buy SMARCE1 monoclonal antibody (M01), clone 6G11 now

Add to cart