SMARCD3 monoclonal antibody (M04), clone 5B6 View larger

SMARCD3 monoclonal antibody (M04), clone 5B6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SMARCD3 monoclonal antibody (M04), clone 5B6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse,Rat
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about SMARCD3 monoclonal antibody (M04), clone 5B6

Brand: Abnova
Reference: H00006604-M04
Product name: SMARCD3 monoclonal antibody (M04), clone 5B6
Product description: Mouse monoclonal antibody raised against a partial recombinant SMARCD3.
Clone: 5B6
Isotype: IgG2a Kappa
Gene id: 6604
Gene name: SMARCD3
Gene alias: BAF60C|CRACD3|MGC111010|Rsc6p
Gene description: SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 3
Genbank accession: NM_001003801
Immunogen: SMARCD3 (NP_001003801, 385 a.a. ~ 483 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: ISALDSKIHETIESINQLKIQRDFMLSFSRDPKGYVQDLLRSQSRDLKVMTDVAGNPEEERRAEFYHQPWSQEAVSRYFYCKIQQRRQELEQSLVVRNT
Protein accession: NP_001003801
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006604-M04-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Mouse,Rat
Application image: H00006604-M04-1-8-1.jpg
Application image note: SMARCD3 monoclonal antibody (M04), clone 5B6 Western Blot analysis of SMARCD3 expression in NIH/3T3( Cat # L018V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SMARCD3 monoclonal antibody (M04), clone 5B6 now

Add to cart