Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SMARCD3 monoclonal antibody (M01A), clone 1G6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about SMARCD3 monoclonal antibody (M01A), clone 1G6
| Brand: | Abnova |
| Reference: | H00006604-M01A |
| Product name: | SMARCD3 monoclonal antibody (M01A), clone 1G6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SMARCD3. |
| Clone: | 1G6 |
| Isotype: | IgG2a Kappa |
| Gene id: | 6604 |
| Gene name: | SMARCD3 |
| Gene alias: | BAF60C|CRACD3|MGC111010|Rsc6p |
| Gene description: | SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 3 |
| Genbank accession: | NM_001003801 |
| Immunogen: | SMARCD3 (NP_001003801, 385 a.a. ~ 483 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | ISALDSKIHETIESINQLKIQRDFMLSFSRDPKGYVQDLLRSQSRDLKVMTDVAGNPEEERRAEFYHQPWSQEAVSRYFYCKIQQRRQELEQSLVVRNT |
| Protein accession: | NP_001003801 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | SMARCD3 monoclonal antibody (M01A), clone 1G6 Western Blot analysis of SMARCD3 expression in K-562 ( Cat # L009V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |